Recombinant Human Glial cell line-Derived Neurotrophic Factor
Glial cell line-derived neurotrophic factor (GDNF) is a neurotrophic factor and a distant member of the TGF-beta super family. It is necessary for neuron survival and phenotypic maintenance in the central and peripheral nervous systems. GDNF can support the differentiation and survival of many neuron subpopulations, especially dopaminergic neurons and motor neurons, as well as sympathetic neurons and Purkinje cells. GDNF has been shown to interact with GFRA2 and GDNF family receptor alpha 1, triggering downstream signaling pathways to promote the development, survival, and maintenance of neuron-neuron and neuron-target tissue interactions. Mutations in this gene may be associated with Hirschsprung's disease, Parkinson's disease, and amyotrophic lateral sclerosis (ALS).
| Catalog No. | 107-14 |
|---|---|
| Country of Manufacture | United States |
| Product Code | rhGDNF |
| Size/Quantity | 10 ug or 100 ug |
| Product use | This product is for research use only. It is not approved for human or animal use, or for application in in vitro diagnostic procedures. |
| Storage | Upon receipt, store at -20°C after receiving. Upon reconstitution, store at 2-8°C for up to one week. For maximal stability, aliquot and store at -20°C. Avoid repeated freeze/ thaw cycles. |
| Shipping | Gel pack |
| Synonyms | Glial-Derived Neurotrophic Factor; ATF-1; ATF2; HFB1- GDNF |
| AA Sequence | MGSSHHHHHHSSGLVPRGSHMSPDKQMAVLPRRER NRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLN VTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNL SRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHI LRKHSAKRCGCI |
| Source | E. coli |
| Molecular Weight | 17.3 kDa |
| Purity | > 95% |
| Physical Appearance | White lyophilized powder. |
| Formulation | Lyophilized from a 0.2μm filtered concentrated solution in 1x PBS with dextran as protectant. |
| Endotoxin | <0.1 ng/μg of protein (<1 EU/μg) |
| Reconstitution | Reconstitute in sterile distilled water or 1x PBS containing 0.1% BSA to a concentration of 0.1- 1.0 mg/mL. |
Product Sheets
Search for a Certificate of Analysis by Lot Number below:
Find answers to common questions about ScienCell products, cell culture, handling, and research applications.
No Publication available at this time.
