Recombinant Murine GM-CSF
This product is for research use only. It is not approved for use in humans, animals, or in vitro diagnostic procedures.
GM-CSF was initially characterized as a factor that can support the in vitro colony formation of granulocyte-macrophage progenitors. It is also a growth factor for erythroid, megakaryocyte, and eosinophil progenitors. GM-CSF is produced by T cells, B cells, macrophages, mast cells, endothelial cells, fibroblasts, and adipocytes in response to cytokine or inflammatory stimuli. On mature hematopoietic cells, GM-CSF acts as a prosurvival factor and activates effector functions of granulocytes, monocytes/macrophages, and eosinophils. It promotes a Th1 biased immune response, angiogenesis, allergic inflammation, and the development of autoimmunity. The 22 kDa glycosylated GM-CSF, similar to IL-3 and IL-5, is a cytokine with a core of four bundled α-helices. Mature mouse GM-CSF shares 49% - 54% amino acid sequence identity with canine, feline, human, and porcine GM-CSF and 69% with rat GM-CSF. The activity of GM-CSF is species specific between human and mouse. Mouse GM-CSF is only weakly active on rat cells, although rat GM-CSF is fully active on mouse cells.
| Catalog No. | 122-03 |
|---|---|
| Country of Manufacture | United States |
| Product Code | rmGM-CSF |
| Size/Quantity | 5 µg, 20 µg and 1 mg |
| Product use | This product is for research use only. It is not approved for use in humans, animals, or in vitro diagnostic procedures. |
| Storage | Store at -20°C after receiving. Upon reconstitution, store at 2-8°C for up to one week. For maximal stability, aliquot and store at -20°C. Avoid repeated freeze/ thaw cycles. |
| Shipping | Dry ice. |
| Synonyms | CSF-2, MGI-1GM, GM-CSF, Pluripoietin-alpha, Molgramostin, Sargramostim |
| AA Sequence | APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEF SFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPP TPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQKAAAHHHHHH |
| Source | Yeast |
| Molecular Weight | Predicted molecular weight at 15.1 kDa. Apparent molecular weight on SDS-PAGE at approximately 17 & 21 kDa due to glycosylation. |
| Purity | > 95% by SDS-PAGE |
| Physical Appearance | White lyophilized powder. |
| Formulation | Lyophilized from a 0.2μm filtered solution in PBS, pH 7.4. |
| Endotoxin | <0.1 ng/μg of protein (<1 EU/μg) |
| Reconstitution | Reconstitute in sterile distilled water containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. |
No Publication available at this time.
