Recombinant Human Platelet-derived Growth Factor-AA
Platelet-derived growth factor (PDGF) presenting in serum but absent from plasma was first discovered in animal study by Lynch and co-workers in the late 1980s. It is a disulfide-linked dimer consisting of two peptides-chain A and chain B. PDGF has three subforms: PDGF-AA, PDGF-BB, PDGF-AB.
Platelet-derived growth factor (PDGF) presenting in serum but absent from plasma was first discovered in animal study by Lynch and co-workers in the late 1980s. It is a disulfide-linked dimer consisting of two peptides-chain A and chain B. PDGF has three subforms: PDGF-AA, PDGF-BB, PDGF-AB. It is involved in a number of biological processes, including hyperplasia, embryonic neuron development, chemotaxis, and respiratory tubule epithelial cell development. The function of PDGF is mediated by two receptors (PDGFR-α and PDGFR-β).
| Catalog No. | 105-08 |
|---|---|
| Country of Manufacture | United States |
| Product Code | rhPDGF-AA |
| Size/Quantity | 10 μg, 50 μg, or 500 μg |
| Product use | This product is for research use only. It is not approved for human or animal use, or for application in in vitro diagnostic procedures. |
| Storage | Store at -20°C after receiving. Upon reconstitution, store at 2-8°C for up to one week. For maximal stability, aliquot and store at -20°C. Avoid repeated freeze/ thaw cycles. |
| Shipping | Gel pack |
| Synonyms | Platelet-Derived Growth Factor-AA, Glioma-derived growth factor (GDGF), Osteosarcoma-derived Growth Factor (ODGF) |
| AA Sequence |
(monomer)
SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKR CTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEV QVRLEEHLECACATTSLNPDYREEDTDVR |
| Source | Yeast |
| Molecular Weight | Approximately 25 kDa, a disulfide-linked homodimeric protein containing two 110 amino acids residues polypeptide. |
| Purity | > 95% by SDS-PAGE |
| Physical Appearance | White lyophilized powder. |
| Formulation | Lyophilized from a 0.2µm filtered concentrated (1mg/ml) solution in PBS, pH 7.4. |
| Endotoxin | <0.1 ng/μg of protein (<1 EU/μg) |
| Reconstitution | Reconstitute in sterile distilled water containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. |
No Publication available at this time.