Recombinant Human NFkB
Upon activation by environmental stimuli such as stress, cytokines, bacterial or viral molecules, NFkB complex could translocate into the nucleus and bind to target DNA, regulating gene expression involved in inflammatory reactions, immune responses, cell proliferation and differentiation, and apoptosis.
NFkB(p50) belongs to the superfamily of human NFkB transcription factors. NFkB family members include p50/p105, p52/p100, RelA(p65), RelB and cRel. NFkB(p50) associates with NFkB family members to form homo- or heterodimers. Upon activation by environmental stimuli such as stress, cytokines, bacterial or viral molecules, NFkB complex could translocate into the nucleus and bind to target DNA, regulating gene expression involved in inflammatory reactions, immune responses, cell proliferation and differentiation, and apoptosis.
| Catalog No. | MB9128 |
|---|---|
| Country of Manufacture | United States |
| Product Code | rhNFkB |
| Size/Quantity | 10 μg, 100 μg, or 500 μg |
| Product use | This product is for research use only. It is not approved for use in humans, animals, or in vitro diagnostic procedures. |
| Storage | Upon reconstitution, store at 2-8°C for up to one week. For maximal stability, aliquot and store at -20°C. Avoid repeated freeze/thaw cycles. |
| Shipping | Gel ice. Store at -20°C after receiving. |
| Synonyms | NFkB1, NF kappaB, NF kappa B, NFkB p50, NFkB p105, Nuclear factor kappa B, EBP-1. |
| AA Sequence | MGSSHHHHHHSSGLVPRGSHMAEDDPYLGRPEQMFHLDP SLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYV CEGPSHGGLPGASSEKNNKSYPQVKICNYVGPAKVIVQLV TNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANL GILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQ AEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTA FLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTA GCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGD FSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLET SEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAG AGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHP GTTKSNAGMKHG |
| Source | Escherichia coli |
| Molecular Weight | Approximately 49.7 kDa |
| Purity | > 95% by SDS-PAGE |
| Physical Appearance | White lyophilized powder. |
| Formulation | Lyophilized from a 0.2µm filtered solution in PBS, pH 7.4. |
| Endotoxin | <0.1 ng/μg of protein (<1 EU/μg) |
| Reconstitution | Reconstitute in sterile distilled water or saline. |
Product Sheets
Search for a Certificate of Analysis by Lot Number below:
Find answers to common questions about ScienCell products, cell culture, handling, and research applications.
No Publication available at this time.
