Recombinant Human DES (1-3) IGF-1
This product is for research use only. It is not approved for use in humans, animals, or in vitro diagnostic procedures.
Human Des(1-3)Insulin-like Growth Factor-I (IGF-I) is a 67 amino acid analog of human IGF-I lacking the N-terminal tripeptide Gly-Pro-Glu. Human Des(1-3)IGF-I is more potent than IGF-I in vitro and in vivo. This increased potency is due to reduced binding of human Des(1-3)IGF-I to most of the IGF binding proteins which normally inhibit the biological actions of IGF-I. Human Des(1-3)IGF-I binds to the Type 1 IGF receptor with similar affinity to full length IGF-I.
| Catalog No. | 105-01B |
|---|---|
| Product Code | rhDES1-3/IGF1 |
| Country of Manufacture | United States or China |
| Size/Quantity | 20ug, 100ug, or 1mg |
| Product use | This product is for research use only. It is not approved for use in humans, animals, or in vitro diagnostic procedures. |
| Storage | Store at -20°C after receiving. Upon reconstitution, store at 2-8°C for up to one week. For maximal stability, aliquot and store at -20°C. Avoid repeated freeze/ thaw cycles. |
| Shipping | Dry ice. |
| AA Sequence | TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLK PAKSA |
| Source | Escherichia coli. |
| Molecular Weight | 7.4 kDa |
| Purity | >97% by SDS-PAGE and HPLC analyses. |
| Biological Activity | The ED50 was determined by a cell proliferation assay using serum free human MCF-7 cells is less than 2 ng/ml, corresponding to a specific activity of >5×10^5 IU/mg. |
| Physical Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
| Endotoxin | Less than 1 EU/μg of rHuDES1-3/IGF1 as determined by LAL method. |
| Reconstitution | Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. |
Product Sheets
Search for a Certificate of Analysis by Lot Number below:
Find answers to common questions about ScienCell products, cell culture, handling, and research applications.
No Publication available at this time.
